Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_373 (MPN_373)
This Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_373 (MPN_373) spans the amino acid sequence from region 1-204.
Product Specifications
Product Name Alternative
Uncharacterized protein MPN_373
UniProt
P75408
Expression Region
1-204
Origin
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVSDGGGQTDNNAEGGNLRIALTKNAFNPNQSTTVDIPYKIENRSVGNNKEQKTLVFDFS GLNPYEYNMIVGALFTDSSFINDAYAPIQSTFQRQLKEFLQVKYENQVGANGSFDLFKPR SLSSQQLVQGERSLDGFTVELNANGGSFNFLTHVDPLVAGLTVAAIASVVVAGAVTYLVV RRYRKRNEFVDKIFASNIRAKQWR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940994-100 1x 100 µL
TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740043-500 1x 500 µL
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details