Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 2 Uncharacterized gene E5 protein (E5)

This Recombinant Equine herpesvirus 2 Uncharacterized gene E5 protein (E5) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Uncharacterized gene E5 protein

UniProt

Q66614

Expression Region

1-206

Origin

Equine herpesvirus 2 (strain 86/87) (EHV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRGRVSGRGGRGEMERRGPPRRIWCPAADAAPRPGSGINPSARPGAMTSAATGEVARSS PRGQPPVARGRVPGCLRHFTGFLFVPYLMPGGQGASKKLSLISDILLLAPHWPLELSLKA SSSLIGQPARHSNYRPFSLAAAAVNQRSWPVIGPALSANRRAAERGTGQSSGGVCVVGVF GSRFIYIYYIYSIYIYRVYTCITGIV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGOT AAV Vector (Human) (CMV)
19044101 1 µg

EGOT AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
IKB alpha (NFKBIA) (NM_020529) Human Over-expression Lysate
E45H11188-2 20 µg

IKB alpha (NFKBIA) (NM_020529) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human ADAM28 shRNA (UAS) - Lentiviral human ADAM28 shRNA (UAS) plasmid
GTR15350182 1 Vial

Lentiviral human ADAM28 shRNA (UAS) - Lentiviral human ADAM28 shRNA (UAS) plasmid

Sign In for Pricing
View Details
BTBD6 Peptide - middle region (AAP39757)
AAP39757-100UG 100 µg

BTBD6 Peptide - middle region (AAP39757)

Sign In for Pricing
View Details
HDAC1, ID (S423) (HDAC1, RPD3L1, Histone deacetylase 1) (FITC)
MBS6305859-01 0.2 mL

HDAC1, ID (S423) (HDAC1, RPD3L1, Histone deacetylase 1) (FITC)

Sign In for Pricing
View Details
HDAC1, ID (S423) (HDAC1, RPD3L1, Histone deacetylase 1) (FITC)
MBS6305859-02 5x 0.2 mL

HDAC1, ID (S423) (HDAC1, RPD3L1, Histone deacetylase 1) (FITC)

Sign In for Pricing
View Details