Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 2 Uncharacterized gene E5 protein (E5)

This Recombinant Equine herpesvirus 2 Uncharacterized gene E5 protein (E5) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Uncharacterized gene E5 protein

UniProt

Q66614

Expression Region

1-206

Origin

Equine herpesvirus 2 (strain 86/87) (EHV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRGRVSGRGGRGEMERRGPPRRIWCPAADAAPRPGSGINPSARPGAMTSAATGEVARSS PRGQPPVARGRVPGCLRHFTGFLFVPYLMPGGQGASKKLSLISDILLLAPHWPLELSLKA SSSLIGQPARHSNYRPFSLAAAAVNQRSWPVIGPALSANRRAAERGTGQSSGGVCVVGVF GSRFIYIYYIYSIYIYRVYTCITGIV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Poldip3 shRNA (UAS) - Lentiviral mouse Poldip3 shRNA (UAS, RFP) (100)
GTR15185160 1 Vial

Lentiviral mouse Poldip3 shRNA (UAS) - Lentiviral mouse Poldip3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Rift Valley Fever Virus Nucleoprotein
OPNB00051-500UG 500 µg

Rift Valley Fever Virus Nucleoprotein

Sign In for Pricing
View Details
Oxamflatin 50mg
A20265-50 50 mg

Oxamflatin 50mg

Sign In for Pricing
View Details
ICOS; AILIM; CD278 Protein (C-Fc, Rhesus macaque)
P515785 100 µg

ICOS; AILIM; CD278 Protein (C-Fc, Rhesus macaque)

Sign In for Pricing
View Details
UltraCruz® Gel Incubation Tray, Green
sc-201756 100/PCK

UltraCruz® Gel Incubation Tray, Green

Sign In for Pricing
View Details
CELLCOAT® plate, 24w, TC, Fibronectin coating, 3,3ml/w, polystyrene, lid with condensation rings, subpacked per 5 pieces, 60 pieces per CAR
662920 60 pieces per CAR

CELLCOAT® plate, 24w, TC, Fibronectin coating, 3,3ml/w, polystyrene, lid with condensation rings, subpacked per 5 pieces, 60 pieces per CAR

Sign In for Pricing
View Details