Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative germ cell-specific gene 1-like protein 2

This Recombinant Human Putative germ cell-specific gene 1-like protein 2 spans the amino acid sequence from region 29-235.

Product Specifications

Product Name Alternative

Putative germ cell-specific gene 1-like protein 2, GSG1-like protein 2

UniProt

A8MUP6

Expression Region

29-235

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SHWCEGTRRVVKPLCQDQPGGQHCIHFKRDNSSNGRMDNNSQAVLYIWELGDDKFIQRGF HVGLWQSCEESLNGEDEKCRSFRSVVPAEEQGVLWLSIGGEVLDIVLILTSAILLGSRVS CRSPGFHWLRVDALVAIFMVLAGLLGMVAHMMYTTIFQITVNLGPEDWKPQTWDYGWSYC LAWGSFALCLAVSVSAMSRFTAARLEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma Marker (KBA.62), CF568 conjugate, 0.1mg/mL
BNC680895-100 1x 100 µL

Melanoma Marker (KBA.62), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708259 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Perylene
TRC-P291300-25G 25 g

Perylene

Sign In for Pricing
View Details
Cal Green™ 1, AM [Equivalent to Calcium Green-1, AM]
20501-AAT 10x 50 µg

Cal Green™ 1, AM [Equivalent to Calcium Green-1, AM]

Sign In for Pricing
View Details
HCAR2 Human Gene Knockout Kit (CRISPR)
KN206527 1 Kit

HCAR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Serum Amyloid A (SAA1) Mouse Monoclonal Antibody [Clone ID: OTI4A10]
CF814056 100 µg

Serum Amyloid A (SAA1) Mouse Monoclonal Antibody [Clone ID: OTI4A10]

Sign In for Pricing
View Details