Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii Electron transport complex protein RnfG (rnfG)

This Recombinant Cronobacter sakazakii Electron transport complex protein RnfG (rnfG) spans the amino acid sequence from region 1-208.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfG

UniProt

A7MML1

Expression Region

1-208

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKTIQKHGVTLAVFAALTTGLTAMVNALTKTTIEGQAALQQKQLFDQVLPPEMYDNDIQ QSCYLVSAPALGRGEKQLWVARKGDTPVAVVMQATAPDGYSGAIQLLVGADFKGTVLGTR VTEHHETPGLGDKIETRISDWITGFAGQVIHGPNDTRWAVKKDGGQFDQFTGATITPRAV VNAVKRAGLYAQTLEPQLSTLPSCGENP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MSRB3 activation kit by CRISPRa
GA116758 1 Kit

Human MSRB3 activation kit by CRISPRa

Sign In for Pricing
View Details
ICAM3 (NM_002162) Human Over-expression Lysate
LY400788 100 µg

ICAM3 (NM_002162) Human Over-expression Lysate

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), CF640R conjugate, 0.1mg/mL
BNC401921-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1921), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
A1BG Human Gene Knockout Kit (CRISPR)
KN421406 1 Kit

A1BG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MFluor™ Violet 500 Anti-human CD38 Antibody *HB7*
10382100-AAT 100 Tests

MFluor™ Violet 500 Anti-human CD38 Antibody *HB7*

Sign In for Pricing
View Details
TMA16 Antibody
OC-2151-01 50 μL

TMA16 Antibody

Sign In for Pricing
View Details