Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Uncharacterized protein HI_0219 (HI_0219)

This Recombinant Haemophilus influenzae Uncharacterized protein HI_0219 (HI_0219) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

Uncharacterized protein HI_0219

UniProt

P44577

Expression Region

1-213

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIYMSVFNTFVEFVARIVAPMQRQFINFIRIAIFIVMAWIGGLKVCQYEADGIAHFVSN SPFFSYMYEKGPNLVPNDKGELVMEYTLHKNPEGKMVAKNIEWHKENGTYTASYIIGAII VTVGILTLAGIWNATAGLAGGLLTFGMSIVTLSFLITTPEAWVPNLGGDLPTPAYGFPYL SGVGRLVIKDIIMMAGGLTAAAECANRILARKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF488A conjugate, 0.1mg/mL
BNC881388-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54), CF647 conjugate, 0.1mg/mL
BNC470054-500 1x 500 µL

HCG-beta (HCGb/54), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), Biotin conjugate, 0.1mg/mL
BNCB0050-500 1x 500 µL

IgA Secretory Component (SC05), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (TS1), CF640R conjugate, 0.1mg/mL
BNC400627-100 1x 100 µL

Cytokeratin 8 (TS1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details