Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Potassium-transporting ATPase C chain (kdpC)

This Recombinant Halobacterium salinarum Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

P57687

Expression Region

1-216

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQDLAVPLRLLGVSLLVFGLLYQGSLMAIGDAVFPNSSAGSPVYVDGQEQPVGSQMIG QQFRPGQPEDVQYFWSRPSANDYNAMTSASTNWGPTNPLLSERVRADLQNISQYETPDDS VPVNLVSESGSSYDAHISPAAAEYQVLRVANQTGISEQRLNEMIDEATKEPWLGIWGHER VNVLELNLMVRDALNEQNETDQNSDMNASEIANGDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cenpw 3'UTR Luciferase Stable Cell Line
TU103728 1.0 mL

Cenpw 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CD105 Antibody
E38PA9764 100 µL

CD105 Antibody

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem I P700 chlorophyll a apoprotein A2 (psaB), partial
MBS7072761 Inquire

Recombinant Synechococcus sp. Photosystem I P700 chlorophyll a apoprotein A2 (psaB), partial

Sign In for Pricing
View Details
PEX2 Protein Lysate
OCOA21012-20UG 20 µg

PEX2 Protein Lysate

Sign In for Pricing
View Details
Plexin A3 (PLXNA3) (NM_017514) Human Untagged Clone
SC308885 10 µg

Plexin A3 (PLXNA3) (NM_017514) Human Untagged Clone

Sign In for Pricing
View Details
ITGA1 (Integrin alpha-1, Integrin, alpha 1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (MaxLight 405)
MBS6190775-01 0.1 mL

ITGA1 (Integrin alpha-1, Integrin, alpha 1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (MaxLight 405)

Sign In for Pricing
View Details