Recombinant Neurospora crassa Altered inheritance of mitochondria protein 31, mitochondrial (aim-31)
This Recombinant Neurospora crassa Altered inheritance of mitochondria protein 31, mitochondrial (aim-31) spans the amino acid sequence from region 1-221.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 31, mitochondrial
UniProt
Q7S455
Expression Region
1-221
Origin
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPNSTDNQGSAPPGLSSRPLPSSFDDNADFYNENGFQKVSRRLREEPLIPIGCIATVAAF TGAYRAMRRGDHEQVQRMFRARVAAQAFTVVAMVAGSWYYAADRQKQKELWKLKEQQDAE EKRQKWIRELEVRDAEDKALQERLEKRRKKKAERDSAAGAPDGVAAQAQAAYADAKEKVS SPAGDVAPEDPNKSNITGVRERLPTWLGGSKGADGSSRDKN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400029-500 1x 500 µL
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details