Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio TM2 domain-containing protein 3 (tm2d3)

This Recombinant Danio rerio TM2 domain-containing protein 3 (tm2d3) spans the amino acid sequence from region 22-244.

Product Specifications

Product Name Alternative

TM2 domain-containing protein 3

UniProt

A5PLF5

Expression Region

22-244

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YLSSPHVGQDPPYLAQQKSVMSSPVALTASSASPVVTDNYVSKCPSGGLCSKLPADCIIC ALHHNCSYGRPHNYTCRPRAGVHCVSDQGERQQNFTLSLLCRFCFQLDASQYRCSNSSDC MTVSCPRRRYNASCEVLEHVHCLGKRVFQKRLFCNWTGGYKWSTALALSITLGGFGADRF YLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF647 conjugate, 0.1mg/mL
BNC472682-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Connecting Transfer Stretcher BHBD-817
BHBD-817 1 Unit

Connecting Transfer Stretcher BHBD-817

Sign In for Pricing
View Details
2'-Deoxyguanosine 3’,5’-Dibutanoate
TRC-D239560-25G 25 g

2'-Deoxyguanosine 3’,5’-Dibutanoate

Sign In for Pricing
View Details
2-Ethylfuran
TRC-E918085-25G 25 g

2-Ethylfuran

Sign In for Pricing
View Details
C18orf63 Antibody
KC-34794-01 50 μL

C18orf63 Antibody

Sign In for Pricing
View Details
C18orf63 Antibody
KC-34794-02 100 µL

C18orf63 Antibody

Sign In for Pricing
View Details