Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Signal peptidase complex subunit 2 (SPCS2)

This Recombinant Dog Signal peptidase complex subunit 2 (SPCS2) spans the amino acid sequence from region 2-226.

Product Specifications

Product Name Alternative

Signal peptidase complex subunit 2, EC= 3.4.-.-, Microsomal signal peptidase 25 kDa subunit, SPase 25 kDa subunit

UniProt

Q28250

Expression Region

2-226

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAASAQGGRTGGGGGSSGPGGGPTCGSGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLATERKIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS808701 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Recombinant CD26 Antibody
RC-15207-01 50 μL

Recombinant CD26 Antibody

Sign In for Pricing
View Details
Recombinant CD26 Antibody
RC-15207-02 100 µL

Recombinant CD26 Antibody

Sign In for Pricing
View Details
Recombinant CD26 Antibody
RC-15207-03 1 mL

Recombinant CD26 Antibody

Sign In for Pricing
View Details
CTNND1 (NM_001085467) Human Over-expression Lysate
LC421316 20 µg

CTNND1 (NM_001085467) Human Over-expression Lysate

Sign In for Pricing
View Details
Bromo(pentyl)triphenylphosphorane
TRC-B699483-500MG 500 mg

Bromo(pentyl)triphenylphosphorane

Sign In for Pricing
View Details