Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable N-acetyltransferase 8 (NAT8)

This Recombinant Human Probable N-acetyltransferase 8 (NAT8) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Probable N-acetyltransferase 8, EC= 2.3.1.-, Camello-like protein 1

UniProt

Q9UHE5

Expression Region

1-227

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSW LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVG MVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTI QLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-500 1x 500 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-500 1x 500 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-500 1x 500 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF640R conjugate, 0.1mg/mL
BNC400674-100 1x 100 µL

Cytokeratin 10 (LH2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details