Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Ankyrin repeat domain-containing protein 46 (ANKRD46)

This Recombinant Pongo abelii Ankyrin repeat domain-containing protein 46 (ANKRD46) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Ankyrin repeat domain-containing protein 46

UniProt

Q5R8C8

Expression Region

1-228

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI CQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV NKDVIRLLEFLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR TTWQEFVEDLGFWRVLLLIFVIALLSLGIAYYVSGVLPFVENQPELVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Rat Reprimo (RPRM) Polyclonal Antibody
VD3N368 1 Each

Rabbit Anti-Rat Reprimo (RPRM) Polyclonal Antibody

Sign In for Pricing
View Details
Trypsin (PRSS3) (NM_007343) Human Over-expression Lysate
LH01303V 100 µg

Trypsin (PRSS3) (NM_007343) Human Over-expression Lysate

Sign In for Pricing
View Details
Human anti-KOD mAb (1HA)
E409C37-hA100-50 50 µg

Human anti-KOD mAb (1HA)

Sign In for Pricing
View Details
Human Kallikrein 10 (KLK10) ELISA Kit
abx152082-01 96 Tests

Human Kallikrein 10 (KLK10) ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 10 (KLK10) ELISA Kit
abx152082-02 5x 96 Tests

Human Kallikrein 10 (KLK10) ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 10 (KLK10) ELISA Kit
abx152082-03 10x 96 Tests

Human Kallikrein 10 (KLK10) ELISA Kit

Sign In for Pricing
View Details