Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Ankyrin repeat domain-containing protein 46 (ANKRD46)

This Recombinant Pongo abelii Ankyrin repeat domain-containing protein 46 (ANKRD46) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Ankyrin repeat domain-containing protein 46

UniProt

Q5R8C8

Expression Region

1-228

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI CQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV NKDVIRLLEFLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR TTWQEFVEDLGFWRVLLLIFVIALLSLGIAYYVSGVLPFVENQPELVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tacr3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
46058116 3x 1.0 µg

Tacr3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
AMK (hydrochloride)
MBS5797367 Inquire

AMK (hydrochloride)

Sign In for Pricing
View Details
ERO1B rabbit pAb
E28PN5352 100 µL

ERO1B rabbit pAb

Sign In for Pricing
View Details
CR1L Antibody - N-terminal region
ARP65875_P050-25UL 25 µL

CR1L Antibody - N-terminal region

Sign In for Pricing
View Details
Ube2g1 (NM_025985) Mouse Tagged Lenti ORF Clone
MR218944L4 10 µg

Ube2g1 (NM_025985) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Nphs2 shRNA (UAS) - Lentiviral mouse Nphs2 shRNA (UAS, RFP) (25)
GTR15171671 1 Vial

Lentiviral mouse Nphs2 shRNA (UAS) - Lentiviral mouse Nphs2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details