Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila simulans Cytochrome c oxidase subunit 2 (mt:CoII)

This Recombinant Drosophila simulans Cytochrome c oxidase subunit 2 (mt:CoII) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

P50253

Expression Region

1-228

Origin

Drosophila simulans (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNNYVNRFLLHGQL IEMIWTILPAIILLFIALPSLRLLYLLDEINEPSVTLKSIGHQWYWSYEYSDFNNIEFDS YMIPTNELTTDGFRLLDVDNRVILPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNHFIKWISSNNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-500 1x 500 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MZ2E/838), CF405S conjugate, 0.1mg/mL
BNC040838-100 1x 100 µL

MAGE A1 (MZ2E/838), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF640R conjugate, 0.1mg/mL
BNC402342-100 1x 100 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details