Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta exaltata Plastid envelope membrane protein (cemA)

This Recombinant Cuscuta exaltata Plastid envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Plastid envelope membrane protein

UniProt

A8W3D2

Expression Region

1-229

Origin

Cuscuta exaltata (Tall dodder)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKKAFTPILYLSFIVFLPWWIYFSFNKCLGSWITNWWNTRESEIFLNDLQEKSILEKL IELEEFLFVDEILKKNSETHPQEFHTGIHKEAIQFIKIQNESYIHMILRLSTNLICVVII SGFYIWRNETLVILNSWSREFLYNLSDTVKVFSILLLTDLCIGFHSPHGWELMIGSIYQD FGFVQNDRIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSIND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Malate Assay Kit
GWB-AXR306 100 Assays

Malate Assay Kit

Sign In for Pricing
View Details
Trmt10b (NM_001013090) Rat Tagged ORF Clone
RR213433 10 µg

Trmt10b (NM_001013090) Rat Tagged ORF Clone

Sign In for Pricing
View Details
(6-Bromo-5-methylpyridin-3-yl) methanamine
FEC23124-01 50 mg

(6-Bromo-5-methylpyridin-3-yl) methanamine

Sign In for Pricing
View Details
(6-Bromo-5-methylpyridin-3-yl) methanamine
FEC23124-02 0.5 g

(6-Bromo-5-methylpyridin-3-yl) methanamine

Sign In for Pricing
View Details
E2F1 Antibody
MBS7116262-01 0.05 mg

E2F1 Antibody

Sign In for Pricing
View Details
E2F1 Antibody
MBS7116262-02 0.1 mg

E2F1 Antibody

Sign In for Pricing
View Details