Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Petunia hybrida Chlorophyll a-b binding protein, chloroplastic

This Recombinant Petunia hybrida Chlorophyll a-b binding protein, chloroplastic spans the amino acid sequence from region 42-270.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein, chloroplastic, LHCI type II CAB

UniProt

P13869

Expression Region

42-270

Origin

Petunia hybrida (Petunia)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VSKFIAPVGSRSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPESLK WNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFTDTTTLFVIELVLI GWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTK EIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFSPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIR2DS4 Human Gene Knockout Kit (CRISPR)
KN423899 1 Kit

KIR2DS4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mini Centrifuge BCMI-404
BCMI-404 1 Unit

Mini Centrifuge BCMI-404

Sign In for Pricing
View Details
Zscan4d Mouse Gene Knockout Kit (CRISPR)
KN520158 1 Kit

Zscan4d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phthalic Acid
TRC-P384480-10G 10 g

Phthalic Acid

Sign In for Pricing
View Details
OR10H1 Human Gene Knockout Kit (CRISPR)
KN421850 1 Kit

OR10H1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF405S conjugate, 0.1mg/mL
BNC043256-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details