Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 266-498.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2

UniProt

P07399

Expression Region

266-498

Origin

Lymphocytic choriomeningitis virus (strain WE) (LCMV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDEEFCDMLRLIDYN KAALSKFKQDVESALHVFKTTLNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGE TSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTS AYLISIFLHFVRIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTIWKRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteinase K, 1ml
PC0712-1ml 1 mL

Proteinase K, 1ml

Sign In for Pricing
View Details
Polystyrene A NH₂
HA25031502.100G 100 g

Polystyrene A NH₂

Sign In for Pricing
View Details
TANC2 Human Gene Knockout Kit (CRISPR)
KN426437 1 Kit

TANC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Ank activation kit by CRISPRa
GA200185 1 Kit

Mouse Ank activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse IL1R1/CD121a Protein (His Tag)
PKSM040477 100 µg

Recombinant Mouse IL1R1/CD121a Protein (His Tag)

Sign In for Pricing
View Details
Human IL12B activation kit by CRISPRa
GA102402 1 Kit

Human IL12B activation kit by CRISPRa

Sign In for Pricing
View Details