What is the catalog number for Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1)?

The catalog number for Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1) is orb2928312.

What sizes are available for Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1)?

Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1) come in?

Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1) is available in 2 different pack sizes.

Is Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1) in stock?

Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1)

This Recombinant Mouse Bcl-2-like protein 1 (Bcl2l1) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Bcl-2-like protein 1, Bcl2-L-1, Apoptosis regulator Bcl-X

UniProt

Q64373

Expression Region

1-233

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK