Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium sp. Nodulation protein nolW (nolW)

This Recombinant Rhizobium sp. Nodulation protein nolW (nolW) spans the amino acid sequence from region 1-234.

Product Specifications

Product Name Alternative

Nodulation protein nolW

UniProt

P55712

Expression Region

1-234

Origin

Rhizobium sp. (strain NGR234)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTTPIPFTPLHMFRRLLCVGLFLFAGIHTTLGATLPLPSTSYKYTVLDQDLSAALQEFG NNLKISVNISAEVKGRIRGRIPELSPREFLDRLTDLYDLQWYYDGVVLYVSAAKEAQTRM LVLSSVHFSAFKLALDKLDISDERYPVRPAPGNGLVLVSGPPRFMALIEQTLNGLLAVAQ AQPRATDTPARESVMVLFRGSSTTVVRGGRPEVFYTSEMLPENDDGGKAELSKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-500 1x 500 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-500 1x 500 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1469), CF647 conjugate, 0.1mg/mL
BNC471469-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1469), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details