Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqeB (yqeB)

This Recombinant Bacillus subtilis Uncharacterized protein yqeB (yqeB) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

Uncharacterized protein yqeB

UniProt

P54447

Expression Region

1-240

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQNQSHTLIGVTKTAVFFLYAALAIIGFAIGYFIPQIAKWALSLPWIPLEGPLRLITSF QGSTASFITALLGMCAGIWFAHSVIAMLLSVKITDHTVEFIKGKKVQTIHSDDIALVFMD HKRLVLLGTAGYELVREEIDEKPVNVEKAFRQHHYEWATDGDPFKDQFRRWIPDAPDLSQ GAHALLKARHKALQDEEKDDIEEFRLELAQLGIVVRDEGTRQYWRKAETYPPKIQLGEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-(4-Chlorobutoxy)-3,4-dihydro-2(1H)-quinolinone
TRC-C365560-50MG 50 mg

7-(4-Chlorobutoxy)-3,4-dihydro-2(1H)-quinolinone

Sign In for Pricing
View Details
Huntingtin (HTT) Human Knockdown Lysate
LY300204 100 µg

Huntingtin (HTT) Human Knockdown Lysate

Sign In for Pricing
View Details
Polystyrene A SH
HA16020004.0.25G 25 g

Polystyrene A SH

Sign In for Pricing
View Details
Mouse Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC) ELISA Kit
RDR-PRKDC-Mu-01 96 Tests

Mouse Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC) ELISA Kit
RDR-PRKDC-Mu-02 48 Tests

Mouse Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC) ELISA Kit

Sign In for Pricing
View Details
COX4 (COX4I1) Rabbit Polyclonal Antibody
TA375014 100 µL

COX4 (COX4I1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details