Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R468 (MIMI_R468)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R468 (MIMI_R468) spans the amino acid sequence from region 1-240.

Product Specifications

Product Name Alternative

Uncharacterized protein R468

UniProt

Q5UQD3

Expression Region

1-240

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLVCVSNHNICIHISVNILFIDIYITILMSKQESDNVFWIYDPMILFRDGNYLKIFPT KDMTQIQVLNALTRLCIYLAIIFVLVSAISGYAYVPIIFILIIIVIYFFNNNKNSVQTEM FDDNYPNTNNSDNIDNTDNIMNKQNYKKISDYNPYMNLTLNDIGSGNDDLEANLVELPKD SNRKFYTTSSTTNPNKQEDFMKWIYDLPETCKENQACCLRHEDVRFKRHNPDIDSPTPNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF7 (h2) : 293T Lysate
sc-370138 100 µg - 200 µL

ZNF7 (h2) : 293T Lysate

Sign In for Pricing
View Details
Artn Protein (N-human IgG1-Fc, Mouse)
P522239 100 µg

Artn Protein (N-human IgG1-Fc, Mouse)

Sign In for Pricing
View Details
Recombinant Human Recombining binding protein suppressor of hairless (SUH), Biotinylated
orb3008733-01 20 µg

Recombinant Human Recombining binding protein suppressor of hairless (SUH), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Recombining binding protein suppressor of hairless (SUH), Biotinylated
orb3008733-02 100 µg

Recombinant Human Recombining binding protein suppressor of hairless (SUH), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Recombining binding protein suppressor of hairless (SUH), Biotinylated
orb3008733-03 1 mg

Recombinant Human Recombining binding protein suppressor of hairless (SUH), Biotinylated

Sign In for Pricing
View Details
Rat Anti-mouse CD23/PE antibody
SLM-30243A-PE-01 25 Tests

Rat Anti-mouse CD23/PE antibody

Sign In for Pricing
View Details