Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sclerotinia sclerotiorum Protein rot1 (rot1)

This Recombinant Sclerotinia sclerotiorum Protein rot1 (rot1) spans the amino acid sequence from region 23-264.

Product Specifications

Product Name Alternative

Protein rot1

UniProt

A7EX99

Expression Region

23-264

Origin

Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APNVDELVGTWSTKSAAVLTGPGFYNPVNDSLLEPTHTGISYSFTADGYYEEAYYRAISN PAKPSCVSSIMQWQHGKFVLNDDGSLSLNPFSVDGRQLESAPCTADTATYTRYNQSETLQ KYQVYTDPYTKLTRLDLYQFDGTPVNPMFLAYSPALMLPTETLNPTSSAKSTSSSKMKRW LGGADEPEEPTTSEGYLLPLNKNAKHISRGIEQPSLIHRIDLDLLWWAGVGMTIFGGAAY LL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-100 1x 100 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), 0.2mg/mL
BNUB0160-500 1x 500 µL

CD20 (B9E9), 0.2mg/mL

Sign In for Pricing
View Details