Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O7:K1 Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

This Recombinant Escherichia coli O7:K1 Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Monofunctional biosynthetic peptidoglycan transglycosylase, Monofunctional TGase, EC= 2.4.2.-

UniProt

B7NKS5

Expression Region

1-242

Origin

Escherichia coli O7:K1 (strain IAI39 / ExPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKSRLTVFSFVRRFLLRLMVVLAVFWGGGIALFSVAPVPFSAVMVERQVSAWLHGNFRY VAHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEQALAHNERNENRIRGASTIS QQTAKNLFLWDGRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGVFGVEAAAQR YFHKPASKLTRSEAALLAAVLPNPLRFKVSAPSGYVRSRQAWILRQMYQLGGEPFMQQHQ LD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Secretory Component / ECM1 (ECM1/2889R), CF740 conjugate, 0.1mg/mL
BNC742889-500 1x 500 µL

Secretory Component / ECM1 (ECM1/2889R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG217), CF488A conjugate, 0.1mg/mL
BNC880217-500 1x 500 µL

Human IgG Immunoglobulin (IG217), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF568 conjugate, 0.1mg/mL
BNC680826-100 1x 100 µL

Ep-CAM / CD326 (EGP40/826), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), CF594 conjugate, 0.1mg/mL
BNC940315-500 1x 500 µL

Heparan Sulphate Proteoglycan (A7L6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF740 conjugate, 0.1mg/mL
BNC740675-100 1x 100 µL

Cytokeratin 6 (LHK6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details