Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Translocation protein SEC62 (SEC62)

This Recombinant Ashbya gossypii Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Translocation protein SEC62

UniProt

Q75D26

Expression Region

1-244

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDPESPLWVATLLRHHKELKQRQGMFQSRHMEFFRFKRFVRALNSDEYRAKSEREPEKY PPVRSEEDARDVFVSLIKAQLVLPCTKLHTAQCREHGLAPSKDYPHLLLSTKATLDADEY YVWTHNPKTLTDYLTVVGVIVGILAFVCYPLWPHSMKRVVYYLSLGLLGLLAVFSALALV RFVIYVLSLAFCSERGGFWIFPNLFEDCGVIASFKPLYGFGETECYGYIKKQKRRKRKLE KKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chloro-2-fluoro-5-methylbenzoic acid
CHA21131-01 250 mg

4-Chloro-2-fluoro-5-methylbenzoic acid

Sign In for Pricing
View Details
4-Chloro-2-fluoro-5-methylbenzoic acid
CHA21131-02 2.5 g

4-Chloro-2-fluoro-5-methylbenzoic acid

Sign In for Pricing
View Details
Recombinant Human Solute Carrier Family 39, Member 6 (SLC39A6)
RPU52253-01 50 µg

Recombinant Human Solute Carrier Family 39, Member 6 (SLC39A6)

Sign In for Pricing
View Details
Recombinant Human Solute Carrier Family 39, Member 6 (SLC39A6)
RPU52253-02 100 µg

Recombinant Human Solute Carrier Family 39, Member 6 (SLC39A6)

Sign In for Pricing
View Details
Recombinant Human Solute Carrier Family 39, Member 6 (SLC39A6)
RPU52253-03 1 mg

Recombinant Human Solute Carrier Family 39, Member 6 (SLC39A6)

Sign In for Pricing
View Details
Fenthion
CS-T-23569 1 Each

Fenthion

Sign In for Pricing
View Details