Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yttA (yttA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yttA (yttA) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yttA

UniProt

Q795Q5

Expression Region

1-248

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEMVLAFLGFLACLIALGYGLYHLVRYVLKKEKRFSKRLFWPLFIGGLVLLFTGAALAEP DTAAANAEKKYSALNAEYKNLTKEHEELEKEYKSVSSEAKKLKDNKEDQDKLEKLKNENS DLKKTQKSLKAEIKELQENQKQLKEDAKTAKAENETLRQDKTKLENQLKETESQTASSHE DTGSSSNNTSKSDETKTADKAEGCNIKGSRNGIYHTPGSTYYDRTTDPAEMFCSVEEAEA AGYRAPKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLD6 Human qPCR Primer Pair (NM_178836)
HP218913 200 Reactions

PLD6 Human qPCR Primer Pair (NM_178836)

Sign In for Pricing
View Details
Quinaldine Red
TRC-Q585003-1G 1 g

Quinaldine Red

Sign In for Pricing
View Details
3,4-Dihydroxyphenylacetic Acid-13C,18O2
TRC-D454252-1MG 1 mg

3,4-Dihydroxyphenylacetic Acid-13C,18O2

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS622950 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: bilateral
CR560104 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
Tissue Total RNA, Lymph node: sentinel
CR562500 5 µg

Tissue Total RNA, Lymph node: sentinel

Sign In for Pricing
View Details