Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Probable capsular polysaccharide biosynthesis protein YwqC (ywqC)

This Recombinant Bacillus subtilis Probable capsular polysaccharide biosynthesis protein YwqC (ywqC) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Probable capsular polysaccharide biosynthesis protein YwqC

UniProt

P96715

Expression Region

1-248

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGESTSLKEILSTLTKRILLIMIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNERK EVQFNDVQTNLQLINTYNVIIKSPAILDEVIKEMGLSMTSQELNDKITVSSEQDSQVVNI SVRDENAETAAHIANTIASVFQDKITSIMNVDNVSILSKAEVSEHPSPVSPKPLLNIAIA FAAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKTLQGFQSEK TGSGHFGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA tag, AlpSdAbs® VHH (HRP)
HA710117 100 µg

HA tag, AlpSdAbs® VHH (HRP)

Sign In for Pricing
View Details
APC Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149E-01 20 Tests

APC Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details
APC Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149E-02 100 Tests

APC Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details
APC Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149E-03 2x 100 Tests

APC Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details
PPBPP1 Human qPCR Primer Pair (NM_001144760)
HP230982 200 Reactions

PPBPP1 Human qPCR Primer Pair (NM_001144760)

Sign In for Pricing
View Details
3-Bromoquinoline
TRC-B686875-25G 25 g

3-Bromoquinoline

Sign In for Pricing
View Details