Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Mitochondrial intermembrane space import and assembly protein 40 (mia40)

This Recombinant Schizosaccharomyces pombe Mitochondrial intermembrane space import and assembly protein 40 (mia40) spans the amino acid sequence from region 62-313.

Product Specifications

Product Name Alternative

Mitochondrial intermembrane space import and assembly protein 40, Mitochondrial import inner membrane translocase TIM40

UniProt

P87059

Expression Region

62-313

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AASLTAGYLLGKNTSNASSSQDNDHPVVGEHVHTETQSYNEPYMQRHRIEDAIEKKMTSE TQPSTDEKGRKVSATENSAPKKTDKEKSSGETAGNILREQIATGKDDDEYARKFEEVEEE SSEESAFNPDTGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSKSEPKGMECLDKFQAMQ ACFQKHPEIYQDMVGESEEEDAETNEKPSTTSDENNQPQSPPSDNASNPEEDVMNMEKEI VNLTPMSVIKEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CECR1 (NM_017424) Human Recombinant Protein
TP308252L 1 mg

CECR1 (NM_017424) Human Recombinant Protein

Sign In for Pricing
View Details
PLCG2 Rabbit Polyclonal Antibody
R1512-4 100 µL

PLCG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Puromycin HCl
SIH-248-50MG 50 mg

Puromycin HCl

Sign In for Pricing
View Details
RAB18 Human Gene Knockout Kit (CRISPR)
KN205505RB 1 Kit

RAB18 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human NRDE2 activation kit by CRISPRa
GA110479 1 Kit

Human NRDE2 activation kit by CRISPRa

Sign In for Pricing
View Details
UAP56 (DDX39B) Mouse Monoclonal Antibody [Clone ID: OTI7H4]
CF812667 100 µg

UAP56 (DDX39B) Mouse Monoclonal Antibody [Clone ID: OTI7H4]

Sign In for Pricing
View Details