Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Uncharacterized protein C1orf43 homolog

This Recombinant Bovine Uncharacterized protein C1orf43 homolog spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Uncharacterized protein C1orf43 homolog

UniProt

Q5E943

Expression Region

1-253

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE EIDIRLSKVQDIKYEPQLLADDDARLLQLETQGNHNCYNYLYRMKALDAIRASEIPFHAE GRHPHSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGLSEYLRYQ EALSELATVVKARSGSSQRQHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELK SFKDNYNTLESTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-100 1x 100 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-500 1x 500 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-100 1x 100 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte Marker (BM-1), CF488A conjugate, 0.1mg/mL
BNC880061-100 1x 100 µL

Granulocyte Marker (BM-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP3 (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040408-500 1x 500 µL

TIMP3 (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details