Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 2 (COX2)

This Recombinant Cytochrome c oxidase subunit 2 (COX2) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

P48870

Expression Region

1-255

Origin

Cyanidium caldarium

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFFFFSFINYKVLNDAARPWQIGFQDPATPIMEGIVNLHHDIIFFLIIIIIFVSWILFR TLFLFNSKTNPVAYNFSHGTFIELLWTLTPSLVLIGIAVPSFALLYSIDEIIDPAITIKA VGRQWYWSYEYSDYVNEENEFLAFHSYILPEEDLELGQFRLLEVDNRIIIPVNTHIRIIV TGADVIHSWAVPSLGVKCDAIPGRLNQISFFIKREGIYYGQCSEICGVNHGFMPIVIEAV SFDDYIRWVQNKILD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF5 (NM_001730) Human Over-expression Lysate
LY419775 100 µg

KLF5 (NM_001730) Human Over-expression Lysate

Sign In for Pricing
View Details
Catalase (CAT) Activity Assay Kit
E-BC-K031-M-01 48 T (16 samples)

Catalase (CAT) Activity Assay Kit

Sign In for Pricing
View Details
Catalase (CAT) Activity Assay Kit
E-BC-K031-M-02 96 T (40 samples)

Catalase (CAT) Activity Assay Kit

Sign In for Pricing
View Details
Septin 8 Recombinant Rabbit Monoclonal Antibody [JE64-99]
HA721055 100 µL

Septin 8 Recombinant Rabbit Monoclonal Antibody [JE64-99]

Sign In for Pricing
View Details
alpha-Hyodeoxycholic Acid
TRC-H998100-5G 5 g

alpha-Hyodeoxycholic Acid

Sign In for Pricing
View Details
Pancreatic Lipase Related Protein 2 (PNLIPRP2) Rabbit Polyclonal Antibody
TA380097 100 µL

Pancreatic Lipase Related Protein 2 (PNLIPRP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details