Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Receptor expression-enhancing protein 4 (Reep4)

This Recombinant Rat Receptor expression-enhancing protein 4 (Reep4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q4QQW1

Expression Region

1-257

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDACIVQAKERSYETMLS FGKRSLNMAASAAVQAATKSQGALAGRLRSFSMQDLRSIPDTSAPTYQDPLYLEDQAPRR RPPIGYRPGGLQDSDTEDECWSDNEIAPQPPVRPREKPLSRSQSLRVVKRKPLVREGTSR SLKVRTRKKTIPSDLDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR1I3 Rabbit pAb
MBS9142602-01 0.02 mL

NR1I3 Rabbit pAb

Sign In for Pricing
View Details
NR1I3 Rabbit pAb
MBS9142602-02 0.05 mL

NR1I3 Rabbit pAb

Sign In for Pricing
View Details
NR1I3 Rabbit pAb
MBS9142602-03 0.1 mL

NR1I3 Rabbit pAb

Sign In for Pricing
View Details
NR1I3 Rabbit pAb
MBS9142602-04 0.2 mL

NR1I3 Rabbit pAb

Sign In for Pricing
View Details
NR1I3 Rabbit pAb
MBS9142602-05 5x 0.2 mL

NR1I3 Rabbit pAb

Sign In for Pricing
View Details
(Z) -3- (2-Phenylhydrazono) cyclohexanone
CBA38545-01 250 mg

(Z) -3- (2-Phenylhydrazono) cyclohexanone

Sign In for Pricing
View Details