Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Receptor expression-enhancing protein 4 (Reep4)

This Recombinant Rat Receptor expression-enhancing protein 4 (Reep4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q4QQW1

Expression Region

1-257

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDACIVQAKERSYETMLS FGKRSLNMAASAAVQAATKSQGALAGRLRSFSMQDLRSIPDTSAPTYQDPLYLEDQAPRR RPPIGYRPGGLQDSDTEDECWSDNEIAPQPPVRPREKPLSRSQSLRVVKRKPLVREGTSR SLKVRTRKKTIPSDLDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcna3 (NM_008418) Mouse Tagged Lenti ORF Clone
MR226742L3 10 µg

Kcna3 (NM_008418) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olr217 CRISPRa sgRNA lentivector (set of three targets)(Rat)
34231126 3x 1.0µg DNA

Olr217 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Chicago Sky Blue 6B
MBS3603794-01 500 mg

Chicago Sky Blue 6B

Sign In for Pricing
View Details
Chicago Sky Blue 6B
MBS3603794-02 5x 500 mg

Chicago Sky Blue 6B

Sign In for Pricing
View Details
SNORD127 AAV Vector (Human) (CMV)
44820101 1 µg

SNORD127 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human NAALADL1 Pre-designed siRNA Set A
SI010211A 1 Each

Human NAALADL1 Pre-designed siRNA Set A

Sign In for Pricing
View Details