Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 107 (CCDC107)

This Recombinant Human Coiled-coil domain-containing protein 107 (CCDC107) spans the amino acid sequence from region 25-283.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 107

UniProt

Q8WV48

Expression Region

25-283

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGALYTAAVAAFVLYKC LQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTTLAGA QQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEAS RPLPEDFCLKEDEEEIGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHS LGWEGGTTAEGRLKQSLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COG3 Human Gene Knockout Kit (CRISPR)
KN211749 1 Kit

COG3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chromane-2-carboxylic Acid
TRC-C427970-500MG 500 mg

Chromane-2-carboxylic Acid

Sign In for Pricing
View Details
Human LAMP3/CD208, Tag Free
HA211259-01 20 µg

Human LAMP3/CD208, Tag Free

Sign In for Pricing
View Details
Human LAMP3/CD208, Tag Free
HA211259-02 50 µg

Human LAMP3/CD208, Tag Free

Sign In for Pricing
View Details
Human LAMP3/CD208, Tag Free
HA211259-03 100 µg

Human LAMP3/CD208, Tag Free

Sign In for Pricing
View Details
HEMK1 (C-term) Rabbit Polyclonal Antibody
AP52029PU-N 400 µL

HEMK1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details