Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leucine-rich repeat-containing protein 55 (Lrrc55)

This Recombinant Mouse Leucine-rich repeat-containing protein 55 (Lrrc55) spans the amino acid sequence from region 48-311.

Product Specifications

Product Name Alternative

Leucine-rich repeat-containing protein 55

UniProt

Q3UY51

Expression Region

48-311

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTSCPVLCTCRNQVVDCSNQRLFSVPPDLPMDTRNLSLAHNRIAAVPPGYLTCYMELRVL DLRNNSLMELPPGLFLHAKRLAHLDLSYNNLSHVPADMFREAHGLVHIDLSHNPWLRRVH PQAFQGLVHLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNR IQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVA TNFLLGITANCCHRWSKANEEEEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (N-Propylaminocarbonyl) benzeneboronic acid
OR3960 1 Each

3- (N-Propylaminocarbonyl) benzeneboronic acid

Sign In for Pricing
View Details
Eph receptor B6 (EPHB6) Mouse Monoclonal Antibody [Clone ID: 2A6B9]
AM06213SU-N 100 µL

Eph receptor B6 (EPHB6) Mouse Monoclonal Antibody [Clone ID: 2A6B9]

Sign In for Pricing
View Details
Recombinant Rat IL-1 beta/IL-1F2
501-RL-010 10 µg

Recombinant Rat IL-1 beta/IL-1F2

Sign In for Pricing
View Details
Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 Antibody
abx114452 100 µL

Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 Antibody

Sign In for Pricing
View Details
Recombinant Edwardsiella ictaluri Membrane protein insertase YidC (yidC)
MBS1107032 Inquire

Recombinant Edwardsiella ictaluri Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Mouse Protein Kinase C Delta (PKCd) ELISA Kit
orb1664094-01 48 Tests

Mouse Protein Kinase C Delta (PKCd) ELISA Kit

Sign In for Pricing
View Details