Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leucine-rich repeat-containing protein 55 (Lrrc55)

This Recombinant Mouse Leucine-rich repeat-containing protein 55 (Lrrc55) spans the amino acid sequence from region 48-311.

Product Specifications

Product Name Alternative

Leucine-rich repeat-containing protein 55

UniProt

Q3UY51

Expression Region

48-311

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTSCPVLCTCRNQVVDCSNQRLFSVPPDLPMDTRNLSLAHNRIAAVPPGYLTCYMELRVL DLRNNSLMELPPGLFLHAKRLAHLDLSYNNLSHVPADMFREAHGLVHIDLSHNPWLRRVH PQAFQGLVHLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNR IQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVA TNFLLGITANCCHRWSKANEEEEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human IL-4 (Interleukin 4) ELISA Kit
E-UNEL-H0096-01 5x 96 Tests

Uncoated Human IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human IL-4 (Interleukin 4) ELISA Kit
E-UNEL-H0096-02 15x 96 Tests

Uncoated Human IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details
ATP5L2, NT (ATP5L2, ATP5K2, ATP synthase subunit g 2, mitochondrial) (APC) discontinued
032288-APC 200 µL

ATP5L2, NT (ATP5L2, ATP5K2, ATP synthase subunit g 2, mitochondrial) (APC) discontinued

Sign In for Pricing
View Details
RACGAP1 Antibody (N-term)
orb1938178-01 50 µL

RACGAP1 Antibody (N-term)

Sign In for Pricing
View Details
RACGAP1 Antibody (N-term)
orb1938178-02 100 µL

RACGAP1 Antibody (N-term)

Sign In for Pricing
View Details
Serine/threonine-Protein Kinase PLK1 (PLK1) Antibody
abx433147 200 µL

Serine/threonine-Protein Kinase PLK1 (PLK1) Antibody

Sign In for Pricing
View Details