Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 158 (Tmem158)

This Recombinant Rat Transmembrane protein 158 (Tmem158) spans the amino acid sequence from region 21-285.

Product Specifications

Product Name Alternative

Transmembrane protein 158, 40 kDa BINP-binding protein, p40BBP, Brain-specific binding protein, Ras-induced senescence protein 1

UniProt

Q91XV7

Expression Region

21-285

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GATDAPGLSGTPPNASANASFTGEHSTPRLLASAASAPPERAGPEEAPAAPCNISVQRQM LSSLLVRWGRPRGLQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRL CVGCGWVRGRLRAPAGAPTALPAYPAAEPGPLWLQGEPRHFCCLDFSLEELQGEPGWRLN RKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTAGAPAAAPAAVPAG TTAAAAAAAAAAAAAAAVTSGVAPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SK-MEL-2 Luciferase Reporter Cell Line
ABC-RC352H 1 Vial

SK-MEL-2 Luciferase Reporter Cell Line

Sign In for Pricing
View Details
Bglap Mouse Gene Knockout Kit (CRISPR)
KN502150 1 Kit

Bglap Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ITGA3 CRISPRa sgRNA lentivector (set of three targets)(Human)
25151121 3x 1.0µg DNA

ITGA3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Tmtc4 (BC031368) Mouse Tagged ORF Clone Lentiviral Particle
MR208391L3V 200 µL

Tmtc4 (BC031368) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD93 Biosimilar Antibody
orb3183249-01 100 µg

CD93 Biosimilar Antibody

Sign In for Pricing
View Details
CD93 Biosimilar Antibody
orb3183249-02 500 µg

CD93 Biosimilar Antibody

Sign In for Pricing
View Details