Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 158 (Tmem158)

This Recombinant Rat Transmembrane protein 158 (Tmem158) spans the amino acid sequence from region 21-285.

Product Specifications

Product Name Alternative

Transmembrane protein 158, 40 kDa BINP-binding protein, p40BBP, Brain-specific binding protein, Ras-induced senescence protein 1

UniProt

Q91XV7

Expression Region

21-285

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GATDAPGLSGTPPNASANASFTGEHSTPRLLASAASAPPERAGPEEAPAAPCNISVQRQM LSSLLVRWGRPRGLQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRL CVGCGWVRGRLRAPAGAPTALPAYPAAEPGPLWLQGEPRHFCCLDFSLEELQGEPGWRLN RKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTAGAPAAAPAAVPAG TTAAAAAAAAAAAAAAAVTSGVAPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKNOX1 Protein Vector (Rat) (pPM-C-HA)
36888026 500 ng

PKNOX1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PALS1 Mouse Monoclonal Antibody [Clone ID: LBI2D3]
AMM12443V 100 µL

PALS1 Mouse Monoclonal Antibody [Clone ID: LBI2D3]

Sign In for Pricing
View Details
Anti-Human SLC25A46 Polyclonal Antibody
HP731014-01 50 µg

Anti-Human SLC25A46 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human SLC25A46 Polyclonal Antibody
HP731014-02 100 µg

Anti-Human SLC25A46 Polyclonal Antibody

Sign In for Pricing
View Details
pOTB7-OXA1L Plasmid
PVT18515 2 µg

pOTB7-OXA1L Plasmid

Sign In for Pricing
View Details
FKBP1B Blocking Peptide
MBS9633511-01 1 mg

FKBP1B Blocking Peptide

Sign In for Pricing
View Details