Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 158 (Tmem158)

This Recombinant Rat Transmembrane protein 158 (Tmem158) spans the amino acid sequence from region 21-285.

Product Specifications

Product Name Alternative

Transmembrane protein 158, 40 kDa BINP-binding protein, p40BBP, Brain-specific binding protein, Ras-induced senescence protein 1

UniProt

Q91XV7

Expression Region

21-285

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GATDAPGLSGTPPNASANASFTGEHSTPRLLASAASAPPERAGPEEAPAAPCNISVQRQM LSSLLVRWGRPRGLQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRL CVGCGWVRGRLRAPAGAPTALPAYPAAEPGPLWLQGEPRHFCCLDFSLEELQGEPGWRLN RKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTAGAPAAAPAAVPAG TTAAAAAAAAAAAAAAAVTSGVAPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLIT3 Recombinant Protein
OPCD07052-200UG 200 µg

SLIT3 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Adarb1 shRNA (UAS) - Lentiviral mouse Adarb1 shRNA (UAS, GFP) (100)
GTR15176457 1 Vial

Lentiviral mouse Adarb1 shRNA (UAS) - Lentiviral mouse Adarb1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
DDX50 Mouse Monoclonal Antibody [Clone ID: OTI4F7]
TA811893 100 µL

DDX50 Mouse Monoclonal Antibody [Clone ID: OTI4F7]

Sign In for Pricing
View Details
ABCB5 3'UTR Lenti-reporter-Luc Vector
11038081 1.0 µg

ABCB5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Calystegine B4
T125519-01 1 mg

Calystegine B4

Sign In for Pricing
View Details
Calystegine B4
T125519-02 5 mg

Calystegine B4

Sign In for Pricing
View Details