Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio RING finger protein 170 (rnf170)

This Recombinant Danio rerio RING finger protein 170 (rnf170) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

RING finger protein 170

UniProt

Q7SZN2

Expression Region

1-266

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGSVCVDGAAAPAPDEASLIEGVSNAVLLVLVLSVTLLAGLTTLLCRSEQQRIHPESQE RVRVVREQLQAEQVSSESRHQFYSDMSCPVCLQQAVLPVETNCGHLFCGSCIIAYWRYGT WLGAISCPICRQMVTLLFPLFQDSEQSAVAADSPVEPTLILTDISDYNRRFSGQPRSLLD RLRDVPTLLRHAFREMFSVGGLFWMFRVRILLCVCGALAYLVSPLDFLPEGVLGLLGFLD DFFVILLLFIYISIMYREVVTQRLAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUN2 (NM_015374) Human Recombinant Protein
TP322038M 100 µg

SUN2 (NM_015374) Human Recombinant Protein

Sign In for Pricing
View Details
ARL17B (NM_001039083) Human Over-expression Lysate
LY422013 100 µg

ARL17B (NM_001039083) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504155 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2783), Biotin conjugate, 0.1mg/mL
BNCB2783-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2783), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Deoxystreptamine-kanosaminide
TRC-D263510-50MG 50 mg

Deoxystreptamine-kanosaminide

Sign In for Pricing
View Details
NDRG2 (NM_201540) Human Recombinant Protein
TP314708M 100 µg

NDRG2 (NM_201540) Human Recombinant Protein

Sign In for Pricing
View Details