Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A Putative immediate early glycoprotein (U18)

This Recombinant Human herpesvirus 6A Putative immediate early glycoprotein (U18) spans the amino acid sequence from region 22-293.

Product Specifications

Product Name Alternative

Putative immediate early glycoprotein, Protein U18

UniProt

Q69553

Expression Region

22-293

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SNFTCEQKIVLIQEHKLRSICISTCYVNGVLAGNSSCVSVKTSYLINLAMLTNGFKAMRV GNITSISEKTAFLRVIINYYFRGVMLRALIAQRLPNAANLSSTVNCWLDDHSAGGVMTLF YGTERIVLNSSTEINASRWISDGQDANGTLNILNERVSLDIYFLSKICPQLSSEIYKKKV AHPKYFSLIKNDTKPKKFLRNTWRSAWSNWYKYKEIKEFLDFSSDYENFSEITYSMSAAG LFFLAGGAFTMLLLLCCLSMITRKHIVKDLGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-500 1x 500 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-500 1x 500 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-100 1x 100 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details