Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ybbP (ybbP)

This Recombinant Bacillus subtilis Uncharacterized protein ybbP (ybbP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Uncharacterized protein ybbP

UniProt

Q45589

Expression Region

1-273

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFEDIPFLQYLGNAVDILLVWYVIYKLIMVIRGTKAVQLLKGIVVIVLVRMASQYLGLS TLQWLMDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTPVEEAQQKTIEAITKAI NYMAKRRIGALLTIERDTGMGDYIETGIPLNAKVSSELLINIFIPNTPLHDGAVIMKNNE IAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTIIVSEETGGVSVAKNGDLHREL TEEALKEMLEAEFKKNTRDTSSNRWYWRGKKNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSL1D1 Rabbit Polyclonal Antibody (BF405)
orb2447181 100 µL

RSL1D1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Smad3 (Phospho-Ser423 + Ser425) Antibody FITC Conjugated
MBS9461287-01 0.1 mL

Smad3 (Phospho-Ser423 + Ser425) Antibody FITC Conjugated

Sign In for Pricing
View Details
Smad3 (Phospho-Ser423 + Ser425) Antibody FITC Conjugated
MBS9461287-02 5x 0.1 mL

Smad3 (Phospho-Ser423 + Ser425) Antibody FITC Conjugated

Sign In for Pricing
View Details
Synphilin-1 (alpha Synuclein-Interacting protein, SNCAIP)
S9116-02 1 mg

Synphilin-1 (alpha Synuclein-Interacting protein, SNCAIP)

Sign In for Pricing
View Details
Rat N-Acetyl Beta-D-Glucosaminidase (NAGase) ELISA Kit
BSKR62774-01 48 Tests

Rat N-Acetyl Beta-D-Glucosaminidase (NAGase) ELISA Kit

Sign In for Pricing
View Details
Rat N-Acetyl Beta-D-Glucosaminidase (NAGase) ELISA Kit
BSKR62774-02 96 Tests

Rat N-Acetyl Beta-D-Glucosaminidase (NAGase) ELISA Kit

Sign In for Pricing
View Details