Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 279/2005 Protein 3 (3)

This Recombinant Bat coronavirus 279/2005 Protein 3 (3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Protein 3, Accessory protein 3

UniProt

Q0Q474

Expression Region

1-274

Origin

Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLFMSIFTLGAITRQPAKVENASPASTVHATATIPLQASLPFGWLVVGVALLAVFQSAS KVIALHKRWQLALYKGIQFVCNLLLLFVTIYSHLLLLAAGMEAQFLYIYALIYILQIVSF CRFIMRCWLCWKCRSKNPLLYDANYFVCWHTNCFDYCIPYNSITDTIVLTSGDGTTQPKL KEDYQIGGYSEDWHSGVKDYVVIHGYFTEIYYQLESTQLSTDTGAENATFFIYSKLVKDV DHVQIHTIDGSSGVVNPAMDPIYDEPTTTTSVPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin (Mitochondrial Marker) (PHB/3230), CF640R conjugate, 0.1mg/mL
BNC403230-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3230), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793E-01 25 µg

APC Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
APC Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793E-02 100 µg

APC Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
MPRA (PAQR7) (C-term) Rabbit Polyclonal Antibody
AP53161PU-N 400 µL

MPRA (PAQR7) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse IFNGR1 Protein (Fc Tag)
PKSM041061-01 10 µg

Recombinant Mouse IFNGR1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IFNGR1 Protein (Fc Tag)
PKSM041061-02 50 µg

Recombinant Mouse IFNGR1 Protein (Fc Tag)

Sign In for Pricing
View Details