Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 279/2005 Protein 3 (3)

This Recombinant Bat coronavirus 279/2005 Protein 3 (3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Protein 3, Accessory protein 3

UniProt

Q0Q474

Expression Region

1-274

Origin

Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLFMSIFTLGAITRQPAKVENASPASTVHATATIPLQASLPFGWLVVGVALLAVFQSAS KVIALHKRWQLALYKGIQFVCNLLLLFVTIYSHLLLLAAGMEAQFLYIYALIYILQIVSF CRFIMRCWLCWKCRSKNPLLYDANYFVCWHTNCFDYCIPYNSITDTIVLTSGDGTTQPKL KEDYQIGGYSEDWHSGVKDYVVIHGYFTEIYYQLESTQLSTDTGAENATFFIYSKLVKDV DHVQIHTIDGSSGVVNPAMDPIYDEPTTTTSVPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS634327 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF568 conjugate, 0.1mg/mL
BNC681832-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF641 Human Gene Knockout Kit (CRISPR)
KN416576 1 Kit

ZNF641 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Topors Mouse Gene Knockout Kit (CRISPR)
KN518064 1 Kit

Topors Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
14-3-3 sigma (SFN) (NM_006142) Human Recombinant Protein
TP304045L 1 mg

14-3-3 sigma (SFN) (NM_006142) Human Recombinant Protein

Sign In for Pricing
View Details
METTL7A Mouse Monoclonal Antibody [Clone ID: OTI4B10]
CF809878 100 µg

METTL7A Mouse Monoclonal Antibody [Clone ID: OTI4B10]

Sign In for Pricing
View Details