Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 279/2005 Protein 3 (3)

This Recombinant Bat coronavirus 279/2005 Protein 3 (3) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Protein 3, Accessory protein 3

UniProt

Q0Q474

Expression Region

1-274

Origin

Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLFMSIFTLGAITRQPAKVENASPASTVHATATIPLQASLPFGWLVVGVALLAVFQSAS KVIALHKRWQLALYKGIQFVCNLLLLFVTIYSHLLLLAAGMEAQFLYIYALIYILQIVSF CRFIMRCWLCWKCRSKNPLLYDANYFVCWHTNCFDYCIPYNSITDTIVLTSGDGTTQPKL KEDYQIGGYSEDWHSGVKDYVVIHGYFTEIYYQLESTQLSTDTGAENATFFIYSKLVKDV DHVQIHTIDGSSGVVNPAMDPIYDEPTTTTSVPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (Dendritic Cells Maturation Marker) (C86/2160R), CF568 conjugate, 0.1mg/mL
BNC682160-500 1x 500 µL

CD86 (Dendritic Cells Maturation Marker) (C86/2160R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Hydroxy-2-(pyridin-4-yl)inden-1-one
TRC-H952820-50MG 50 mg

3-Hydroxy-2-(pyridin-4-yl)inden-1-one

Sign In for Pricing
View Details
RAD51 Human Knockdown Lysate
LY300286 100 µg

RAD51 Human Knockdown Lysate

Sign In for Pricing
View Details
AFAP (AFAP1) (NM_021638) Human Over-expression Lysate
LC402869 20 µg

AFAP (AFAP1) (NM_021638) Human Over-expression Lysate

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF568 conjugate, 0.1mg/mL
BNC681505-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Acetamido-5-nitrophenylboronic Acid Pinacol Ester
TRC-A145015-250MG 250 mg

2-Acetamido-5-nitrophenylboronic Acid Pinacol Ester

Sign In for Pricing
View Details