Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 056R (IIV6-056R)

This Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 056R (IIV6-056R) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Uncharacterized protein 056R

UniProt

O55703

Expression Region

1-283

Origin

Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQKIDKKNSYSFGITSSTTVHVLGEVVAIGGILYYTHSQVNQLNTKIASLEKQILDLTN ILKHLSPHSFQQLQSSPTTQSTPPLPQSTPQSQQSQQSAVLPQRPSFLGGSTPKESQSFP GVETRSLGEKTTRGKLKSPHPSQIPVTQENFHYPYQTMNKTMRWEFLKPVESDESEDETN CQNGVCTLQKQEKNVTFNGSVEQLKYGNFSPQRSTKTMIGSPSIRPLIPHESIESVSESI ESSQDQSFSSRETISGNFKSKDDHQLSESEINQLVSKAIRTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-100 1x 100 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-100 1x 100 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details