Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tryptase gamma (TPSG1)

This Recombinant Human Tryptase gamma (TPSG1) spans the amino acid sequence from region 38-321.

Product Specifications

Product Name Alternative

Tryptase gamma, EC= 3.4.21.-, Serine protease 31, Transmembrane tryptase, Cleaved into the following 2 chains:, 1. Tryptase gamma light chain, 2. Tryptase gamma heavy chain

UniProt

Q9NRR2

Expression Region

38-321

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELE ITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGI RCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDA CQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSES GYPRLPLLAGLFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf60 (NM_175874) Human Recombinant Protein
TP307948L 1 mg

C12orf60 (NM_175874) Human Recombinant Protein

Sign In for Pricing
View Details
Uncoated Human C3a (Complement Component 3a) ELISA Kit
E-UNEL-H0021-01 5x 96 Tests

Uncoated Human C3a (Complement Component 3a) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human C3a (Complement Component 3a) ELISA Kit
E-UNEL-H0021-02 15x 96 Tests

Uncoated Human C3a (Complement Component 3a) ELISA Kit

Sign In for Pricing
View Details
PRKCD Antibody
KC-1896-01 50 μL

PRKCD Antibody

Sign In for Pricing
View Details
PRKCD Antibody
KC-1896-02 100 µL

PRKCD Antibody

Sign In for Pricing
View Details
PRKCD Antibody
KC-1896-03 1 mL

PRKCD Antibody

Sign In for Pricing
View Details