Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger protein 170 (Rnf170)

This Recombinant Mouse RING finger protein 170 (Rnf170) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

RING finger protein 170

UniProt

Q8CBG9

Expression Region

1-286

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRYWRFQDNKIQDICFGVLGESWIQRPVMARYYSEGQSLQQDDSFIEGVSDQVLVAVVV SLALTATLLYALLRNVQQNIHPENQELVRVLREQFQTEQDVPAPARQQFYTEMYCPICLH QASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRL RQDVNDYNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFY LISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMP3 Antibody
KC-9734-01 50 μL

LAMP3 Antibody

Sign In for Pricing
View Details
LAMP3 Antibody
KC-9734-02 100 µL

LAMP3 Antibody

Sign In for Pricing
View Details
LAMP3 Antibody
KC-9734-03 1 mL

LAMP3 Antibody

Sign In for Pricing
View Details
Canine PDGF R beta / CD140b Protein, His Tag
PDB-C52H3-1mg 1 mg

Canine PDGF R beta / CD140b Protein, His Tag

Sign In for Pricing
View Details
Arhgef40 Mouse Gene Knockout Kit (CRISPR)
KN501542 1 Kit

Arhgef40 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Atomic Absorption Spectrophotometer BAAS-601
BAAS-601 1 Unit

Atomic Absorption Spectrophotometer BAAS-601

Sign In for Pricing
View Details