Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger protein 170 (Rnf170)

This Recombinant Mouse RING finger protein 170 (Rnf170) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

RING finger protein 170

UniProt

Q8CBG9

Expression Region

1-286

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRYWRFQDNKIQDICFGVLGESWIQRPVMARYYSEGQSLQQDDSFIEGVSDQVLVAVVV SLALTATLLYALLRNVQQNIHPENQELVRVLREQFQTEQDVPAPARQQFYTEMYCPICLH QASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRL RQDVNDYNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFY LISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS646572 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
o,m,p-Isopropylphenyl Phenyl Phosphate Mixture (1:1:1)
TRC-I873020-5MG 5 mg

o,m,p-Isopropylphenyl Phenyl Phosphate Mixture (1:1:1)

Sign In for Pricing
View Details
Human NCF2 activation kit by CRISPRa
GA103118 1 Kit

Human NCF2 activation kit by CRISPRa

Sign In for Pricing
View Details
QuicKey Pro Rabbit Cortisol ELISA Kit
E-OSEL-RB0002-01 24 Tests

QuicKey Pro Rabbit Cortisol ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Rabbit Cortisol ELISA Kit
E-OSEL-RB0002-02 48 Tests

QuicKey Pro Rabbit Cortisol ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Rabbit Cortisol ELISA Kit
E-OSEL-RB0002-03 96 Tests

QuicKey Pro Rabbit Cortisol ELISA Kit

Sign In for Pricing
View Details