Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger protein 170 (Rnf170)

This Recombinant Mouse RING finger protein 170 (Rnf170) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

RING finger protein 170

UniProt

Q8CBG9

Expression Region

1-286

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRYWRFQDNKIQDICFGVLGESWIQRPVMARYYSEGQSLQQDDSFIEGVSDQVLVAVVV SLALTATLLYALLRNVQQNIHPENQELVRVLREQFQTEQDVPAPARQQFYTEMYCPICLH QASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRL RQDVNDYNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFY LISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a20 Mouse Gene Knockout Kit (CRISPR)
KN515931 1 Kit

Slc22a20 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Protocatechuic Acid Diacetate
TRC-P838890-5G 5 g

Protocatechuic Acid Diacetate

Sign In for Pricing
View Details
UBE3A Antibody
KC-2327-01 50 μL

UBE3A Antibody

Sign In for Pricing
View Details
UBE3A Antibody
KC-2327-02 100 µL

UBE3A Antibody

Sign In for Pricing
View Details
UBE3A Antibody
KC-2327-03 1 mL

UBE3A Antibody

Sign In for Pricing
View Details
Arhgef2 Sheep Polyclonal Antibody
AP05081PU-N 250 µg

Arhgef2 Sheep Polyclonal Antibody

Sign In for Pricing
View Details