Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Golgi to ER traffic protein 2 (GET2)

This Recombinant Ashbya gossypii Golgi to ER traffic protein 2 (GET2) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Golgi to ER traffic protein 2

UniProt

Q75CF5

Expression Region

1-289

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEVSEAEKRRILREKRKQKFSKGAGSARLHKITTQQPGGASGDSTVTSAEISDNEGSLQ RGSNSGQSTREIDDLLAAMDPPIEPAEPLESAAPEVAFIQQLMKMQQGSATPPADEKAGG LFSPLLERLAEQEAGGAPVVSGEVGVHQFQVRQLKAYMLLLRWAILLPFIYYVMHPGTAH WLHTSRFLHFVMEPRNFFMVFTTFEVASISIYYQVLLTLERTNKVNSLSYSSKLVTWAGL VPDGMLPIDNLQGKVVVALHYWDILSMYLTDLSLCLVAAGLMKYYHAAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC709), CF594 conjugate, 0.1mg/mL
BNC940709-100 1x 100 µL

Human Kappa Light Chain (KLC709), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF488A conjugate, 0.1mg/mL
BNC881505-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), 1mg/mL
BNUM0391-50 1x 50 µL

CD81 / TAPA-1 (1.3.3.22), 1mg/mL

Sign In for Pricing
View Details