Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ERGIC1)

This Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ERGIC1) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 1, ER-Golgi intermediate compartment 32 kDa protein, ERGIC-32

UniProt

Q969X5

Expression Region

1-290

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDD PDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQ FSINKVPGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSN PLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITV KYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKMH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRMS1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-1015R-BF350 100 µL

BRMS1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
PITPNB AAV Vector (Human) (CMV)
36846101 1 µg

PITPNB AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
TMEM163 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
46927061 1.0 µg DNA

TMEM163 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Carbol Fuchsin
18400035-01 5 g

Carbol Fuchsin

Sign In for Pricing
View Details
Carbol Fuchsin
18400035-02 25 g

Carbol Fuchsin

Sign In for Pricing
View Details
Carbol Fuchsin
18400035-03 50 g

Carbol Fuchsin

Sign In for Pricing
View Details